IFNA5 Rabbit Polyclonal Antibody

SKU TA335047

Rabbit Polyclonal Anti-IFNA5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: interferon alpha 5
• Database Link:
  NP_002160
  P01569
• Background: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
• Synonyms: IFN-alpha-5; IFN-alphaG; INA5; INFA5; leIF G
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 85%; Guinea pig: 85%; Rat: 77%; Horse: 77%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway