SLC35F4 Rabbit Polyclonal Antibody

CAT#: TA334862

Rabbit Polyclonal Anti-SLC35F4 Antibody

Product Images

Host: Rabbit; Target Name: SLC35F4; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC35F4 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35F4. Synthetic peptide located within the following region: LLMLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: solute carrier family 35 member F4
• Database Link:
  NP_001193849
  Entrez Gene 341880 Human
  UniProt ID A4IF30
• Background: The function of this protein remains unknown.
• Synonyms: C14orf36; c14_5373
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane