Isochorismatase domain containing protein 1 (ISOC1) Rabbit Polyclonal Antibody

CAT#: TA334313

Rabbit Polyclonal Anti-ISOC1 Antibody

Product Images

WB Suggested Anti-ISOC1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ISOC1 antibody is: synthetic peptide directed towards the C-terminal region of Human ISOC1. Synthetic peptide located within the following region: DATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: isochorismatase domain containing 1
• Database Link:
  NP_057132
  Entrez Gene 51015 Human
  UniProt ID Q96CN7
• Background: The function of this protein remains unknown.
• Synonyms: CGI-111
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%