PNLIPRP3 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PNLIPRP3 Antibody is: synthetic peptide directed towards the C-terminal region of Human PNLIPRP3. Synthetic peptide located within the following region: IVSGKLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVI |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 52 kDa |
| Gene Name | pancreatic lipase related protein 3 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | OTTHUMP00000020563; pancreatic lipase-related protein 3 |
| Note | Immunogen sequence homology: Human: 100% |
| Reference Data | |
| Protein Categories | Secreated Proteins |
| Protein Families | Druggable Genome |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Mxra8 is a receptor for multiple arthritogenic alphaviruses
Zhang, Kim, Fox et al
Nature (2018) 557 (7706), 570-574 DOI: 10.1038/s41586-018-0121-3
Zhang, Kim, Fox et al
Nature (2018) 557 (7706), 570-574 DOI: 10.1038/s41586-018-0121-3
AI Summary: OriGene’s human MXRA8 cDNA clone with C-terminal Myc and Flag tags (Cat. No. RC200955) was used as a template to generate various MXRA8 isoforms for functional studies of alphavirus entry in this research.
Snippet: Letter.;2 (NM_032348.3) containing C-terminal Myc and Flag tags was purchased from OriGene (Cat. … RC200955), and cloned into the lentivirus vector pCSII-EF1-IRES-Venus. Isoform 1 (NM_001282585.1), isoform 3 (NM_001282584.1) and isoform 4 (NM_001282583.1) were created by either mutagenesis of isoform 2 or gene synthesis (Integrated DNA Technologies), and cloned into the lentivirus vector pCSII-EF1-IRES-Venus containing C terminus Myc and Flag tags
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
