SLC25A45 Rabbit Polyclonal Antibody

CAT#: TA334123

Rabbit Polyclonal Anti-SLC25A45 Antibody

Product Images

WB Suggested Anti-SLC25A45 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A45 Antibody: synthetic peptide directed towards the C terminal of human LOC283130. Synthetic peptide located within the following region: GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: solute carrier family 25 member 45
• Database Link:
  NP_001070709
  Entrez Gene 283130 Human
  UniProt ID Q8N413
• Background: The function remains unknown.
• Synonyms: AW491445; member 45; solute carrier family 25
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane