TULP2 Rabbit Polyclonal Antibody

SKU TA334013

Rabbit Polyclonal Anti-TULP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TULP2 Antibody: synthetic peptide directed towards the middle region of human TULP2. Synthetic peptide located within the following region: RKRRRSKTSNYLISLDPTLLSRDGDNFVGKVRSNVFSTKFTIFDNGVNPD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: tubby like protein 2
• Database Link:
  NP_003314
  O00295
• Background: TULP2 is a member of a family of tubby-like genes (TULPs) that encode proteins of unknown function. Members of this family have been identified in plants, vertebrates, and invertebrates. The TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. TULP2 is a member of a family of tubby-like genes (TULPs) that encode proteins of unknown function. Members of this family have been identified in plants, vertebrates, and invertebrates. The TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues.
• Synonyms: CT65; TUBL2
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Rat: 86%; Mouse: 86%; Bovine: 86%; Dog: 80%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data