SLC25A36 Rabbit Polyclonal Antibody

SKU TA333757

Rabbit Polyclonal Anti-SLC25A36 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A36 Antibody: synthetic peptide directed towards the N terminal of human SLC25A36. Synthetic peptide located within the following region: SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: solute carrier family 25 member 36
• Database Link:
  NP_060625
  Q96CQ1
• Background: SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.
• Synonyms: PNC2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane