C1orf149 (MEAF6) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-FLJ11730 Antibody: synthetic peptide directed towards the N terminal of human FLJ11730. Synthetic peptide located within the following region: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 23 kDa |
| Gene Name | MYST/Esa1 associated factor 6 |
| Database Link | |
| Background | The screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognized by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients. Sera from two patients were used to immunoscreen cDNA libraries from two synovial sarcoma cell lines and normal testis, resulting in the identification of 113 distinct antigens. Sarcoma antigen NY-SAR-91 is one of them. |
| Synonyms | C1orf149; CENP-28; EAF6; NY-SAR-91 |
| Note | Immunogen sequence homology: Bovine:100%; Western clawed frog:100%; Chicken:100%; African clawed frog:100%; Green puffer:100%; Zebra finch:100%; Mouse:100%; Human:100%; Rat:100%; Zebrafish:92%; Atlantic salmon:92%; Rainbow smelt:85%; Filarial nematode wor |
| Reference Data | |
| Protein Categories | Growth Factors, Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
