ZNF426 Rabbit Polyclonal Antibody

CAT#: TA333686

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZNF426 Antibody



USD 410.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF426 Antibody: synthetic peptide directed towards the N terminal of human ZNF426. Synthetic peptide located within the following region: VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 63 kDa
Gene Name zinc finger protein 426
Background ZNF426 gene located on chromosome 19.
Synonyms K-RBP
Note Immunogen sequence homology: Human: 100%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families Transcription Factors
Other products for "ZNF426"
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 426 (ZNF426)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 186.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.