ZNF426 Rabbit Polyclonal Antibody

CAT#: TA333686

Rabbit Polyclonal Anti-ZNF426 Antibody

Product Images

WB Suggested Anti-ZNF426 Antibody; Titration: 2.5 ug/ml; Positive Control: Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF426 Antibody: synthetic peptide directed towards the N terminal of human ZNF426. Synthetic peptide located within the following region: VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: zinc finger protein 426
• Database Link:
  NP_077011
  Entrez Gene 79088 Human
  UniProt ID Q9BUY5
• Background: ZNF426 gene located on chromosome 19.
• Synonyms: K-RBP
• Note: Immunogen sequence homology: Human: 100%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Transcription Factors