SLC25A46 Rabbit Polyclonal Antibody

SKU TA333536

Rabbit Polyclonal Anti-SLC25A46 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A46 Antibody: synthetic peptide directed towards the C terminal of human SLC25A46. Synthetic peptide located within the following region: LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: solute carrier family 25 member 46
• Database Link:
  NP_620128
  Q96AG3
• Background: SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]). [supplied by OMIM]
• Synonyms: HMSN6B
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%

Reference Data