ANKRD22 Rabbit Polyclonal Antibody

SKU TA333515

Rabbit Polyclonal Anti-ANKRD22 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ANKRD22 Antibody is: synthetic peptide directed towards the N-terminal region of Human ANKRD22. Synthetic peptide located within the following region: CRRGHVRIVSFLLRRNANVNLKNQKERTCLHYAVKKKFTFIDYLLIILLM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: ankyrin repeat domain 22
• Database Link:
  NP_653191
  Q5VYY1
• Background: The function of this protein remains unknown.
• Synonyms: MGC22805
• Note: Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 82%; Dog: 79%

Reference Data

• Protein Families: Transmembrane