ATAD3C Rabbit Polyclonal Antibody

CAT#: TA332239

Rabbit Polyclonal Anti-ATAD3C Antibody

Product Images

Host: Rabbit; Target Name: ATAD3C; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ATAD3C Antibody is: synthetic peptide directed towards the N-terminal region of Human ATAD3C. Synthetic peptide located within the following region: QMQEQTLQLEQQSKLKQLVNEDLRKQEESVQKHHQTFLESIRAAGTLFGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: ATPase family, AAA domain containing 3C
• Database Link:
  NP_001034300
  Entrez Gene 219293 Human
  UniProt ID Q5T2N8
• Background: The function of this protein remains unknown.
• Synonyms: FLJ34599; FLJ37183
• Note: Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%; Bovine: 85%; Zebrafish: 85%; Guinea pig: 85%; Horse: 75%; Rabbit: 75%