P2Y4 (P2RY4) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-P2RY4 Antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY4. Synthetic peptide located within the following region: VTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVS |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 40 kDa |
| Gene Name | pyrimidinergic receptor P2Y4 |
| Database Link | |
| Background | The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is responsive to uridine nucleotides, partially responsive to ATP, and not responsive to ADP. |
| Synonyms | NRU; P2P; P2Y4; UNR |
| Note | Immunogen sequence homology: Human: 100%; Rat: 85% |
| Reference Data | |
| Protein Categories | GPCR, Membrane Proteins |
| Protein Families | Druggable Genome |
| Protein Pathways | Neuroactive ligand-receptor interaction |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
