Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 51 kDa |
| Gene Name | retinoid X receptor alpha |
| Database Link | |
| Background | Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. RXRA is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators.Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Synonyms | NR2B1 |
| Note | Immunogen sequence homology: Human: 100%; Dog: 88%; Pig: 88%; Rat: 88%; Mouse: 88%; Guinea pig: 88%; Bovine: 75% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Transciption Factors |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
| Protein Pathways | Adipocytokine signaling pathway, Non-small cell lung cancer, Pathways in cancer, PPAR signaling pathway, Small cell lung cancer, Thyroid cancer |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Ameliorative effects of pepsin-digested chicken liver hydrolysates on development of alcoholic fatty livers in mice
Lin, Tai, Chen et al
Food Funct (2017) 8 (5), 1763-1774 DOI: 10.1039/c7fo00123a
Lin, Tai, Chen et al
Food Funct (2017) 8 (5), 1763-1774 DOI: 10.1039/c7fo00123a
Cited by 46
AI Summary: In this study, OriGene products including the Mouse SOD ELISA Kit (Cat# SEB526Mu) and Mouse CAT ELISA Kit (Cat# SEA402Mu) were used to measure antioxidant enzyme activities, contributing to the evaluation of the protective effects of chicken liver hydrolysates against alcoholic fatty liver development in mice.
Ameliorative effects of pepsin-digested chicken liver hydrolysates on development of alcoholic fatty livers in mice
Lin, Tai, Chen et al
Food & Function (2017)
Lin, Tai, Chen et al
Food & Function (2017)
AI Summary: In this study, OriGene's retinoid X receptor alpha (RXR-α; Cat. #: TA332108) antibody was used for Western blot analysis to assess protein expression levels in mouse liver samples.
Snippet: The membrane was first blocked with 5% fa tfree milk for two h at 4 o C and then 307 incubated with primary antibodies against, beta act in (βactin;Cat. #: MAB1501, Merck 308 Millipore, Darmstadf, Germany), retinoid X receptor alpha ( RXRα;Cat. #: TA332108, OriGene Technologies, Inc., Rockville, MD, USA)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
