ZNF12 Rabbit Polyclonal Antibody

SKU TA331920

Rabbit Polyclonal Anti-ZNF12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF12 Antibody: synthetic peptide directed towards the N terminal of human ZNF12. Synthetic peptide located within the following region: ADECSGCGKSLLHIKLEKTHPGDQAYEFNQNGEPYTLNEESLYQKIRILE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 77 kDa
• Gene Name: zinc finger protein 12
• Database Link:
  NP_057349
  P17014
• Background: Two members of the human zinc finger Kruppel family, ZNF 12 (KOX 3) and ZNF 26 (KOX 20), have been localized by somatic cell hybrid analysis and in situ chromosomal hybridization. The presence of individual human zinc finger genes in mouse-human hybrid DNAs was correlated with the presence of specific human chromosomes or regions of chromosomes in the corresponding cell hybrids. Analysis of such mouse-human hybrid DNAs assigned the ZNF 12 (KOX 3) gene to chromosome region 7p.
• Synonyms: GIOT-3; HZF11; KOX3; ZNF325
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 86%; Horse: 79%

Reference Data

• Protein Families: Transcription Factors