OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

p66 beta (GATAD2B) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA331822
Rabbit Polyclonal Anti-GATAD2B Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY412392 Transient overexpression lysate of GATA zinc finger domain containing 2B (GATAD2B) (as WB positive control) 100 ug
$436.00

View other "p66 beta or NM_020699" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GATAD2B Antibody: synthetic peptide directed towards the N terminal of human GATAD2B. Synthetic peptide located within the following region: HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 65 kDa
Gene Name GATA zinc finger domain containing 2B
Database Link
Background GATAD2B contains 1GATA-type zinc finger. GATAD2B was identified as potent transcriptional repressors interacting with MBD2 and MBD3. GATAD2B, one of the Mi-2/NuRD complex subunits, mediate MBD2 and histone interaction
Synonyms MRD18; P66beta; p68
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products