PRDM14 Rabbit Polyclonal Antibody

CAT#: TA331744

Rabbit Polyclonal Anti-PRDM14 Antibody

Product Images

WB Suggested Anti-PRDM14 Antibody Titration: 1.25ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRDM14 Antibody: synthetic peptide directed towards the middle region of human PRDM14. Synthetic peptide located within the following region: GVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: PR domain 14
• Database Link:
  NP_078780
  Entrez Gene 63978 Human
  UniProt ID Q9GZV8
• Background: PRDM14 is part of a family of PR-domain genes that are involved in tumorigenesis.
• Synonyms: PFM11
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%

Reference Data

• Protein Families: Transcription Factors