FAM108A1 (ABHD17A) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-FAM108A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM108A1. Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 39 kDa |
| Gene Name | abhydrolase domain containing 17A |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | C19orf27; FAM108A1 |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Families | Protease |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Activity-dependent post-translational regulation of palmitoylating and depalmitoylating enzymes in the hippocampus
Abazari, Wild, Qiu et al
J Cell Sci (2023) 136 (7) DOI: 10.1242/jcs.260629
Abazari, Wild, Qiu et al
J Cell Sci (2023) 136 (7) DOI: 10.1242/jcs.260629
Cited by 22
AI Summary: OriGene’s anti-ABHD17 antibody (TA331704) was used in this study to detect ABHD17 protein levels, helping to assess the post-translational regulation of depalmitoylating enzymes in hippocampal neurons.
Snippet: :1000, Cell Signaling Technology, 5243S), anti-HA (1:1000, Cell Signaling Technology, C29F4), anti-myc (1:1000, Cell Signaling Technology, 2276), anti-GFP (1:3000, Abcam, ab290), anti-ABHD17 (1:1000, Origene TA331704), anti-ABHD17 (1:1000, Proteintech, 15854-1-AP), anti-FLAG (1:1000, Sigma-Aldrich, F7425), anti-PSD-95 (1:500, Abcam, ab2723), anti-APT2 (1:500, Abcam, ab151578), anti-TC10 (1:1000, A;(1:1000, Origene TA331704), anti-ABHD17 (1:1000, Proteintech, 15854-1-AP), anti-FLAG (1:1000, Sigma-Aldrich, F7425), anti-PSD-95 (1:500, Abcam, ab2723), anti-APT2 (1:500, Abcam, ab151578), anti-TC10 (1:1000, Abcam, ab168645) and anti-N-Ras (1:500, Santa Cruz Biotechnology, sc-31)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
