Foxo6 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-FOXO6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGAPVPGPLS |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 61 kDa |
| Gene Name | forkhead box O6 |
| Database Link | |
| Background | Murine Foxo6 is a member of the murine forkhead family of transcription factors. This family consists of over 30 members, the vast majority of which is important in embryonic development. These forkhead transcription factors may play a role in maintenance and survival of developing and adult neurons. |
| Synonyms | Foxo6 |
| Note | Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Human: 86%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
FOXOs modulate proteasome activity in human induced pluripotent stem cells of Huntington's disease and their derived neural cells
Liu, Qiao, Leiferman et al
Hum. Mol. Genet. (2017)
Liu, Qiao, Leiferman et al
Hum. Mol. Genet. (2017)
Cited by 37
AI Summary: In this study, the OriGene anti-FOXO6 antibody was used to detect FOXO6 protein levels, contributing to the analysis of FOXO transcription factor expression in Huntington's disease and control stem cell-derived neural cells.
Snippet: Signaling), anti-FOXO4 antibody (1:1000, Cell Signaling), anti-FOXO6 antibody (1:1000, OriGene), anti-hSOX2 (1:1000, R&D Systems), anti-p-AKT (1:1000, Cell Signaling), anti-AKT (1:1000, Cell Signaling), anti-GAPDH (1:1000, Cell Signaling), or with an anti-actin ... All 3 versions Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
