Foxo6 Rabbit Polyclonal Antibody

CAT#: TA331437

Rabbit polyclonal Anti-FOXO6 Antibody

Product Images

WB Suggested Anti-FOXO6 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:62500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXO6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGAPVPGPLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: forkhead box O6
• Database Link:
  NP_918949
  Entrez Gene 329934 Mouse
  UniProt ID Q70KY4
• Background: Murine Foxo6 is a member of the murine forkhead family of transcription factors. This family consists of over 30 members, the vast majority of which is important in embryonic development. These forkhead transcription factors may play a role in maintenance and survival of developing and adult neurons.
• Synonyms: Foxo6
• Note: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Human: 86%; Guinea pig: 86%