Germany
Japan
United Kingdom
China
C20orf112 (NOL4L) Rabbit Polyclonal Antibody
Product Images
USD 665.00
USD 200.00
USD 867.00
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-C20orf112 antibody is: synthetic peptide directed towards the N-terminal region of Human C20orf112. Synthetic peptide located within the following region: LRVMNSQEQDETSVSSEDFDMSDSTWMSADPHLASSLSPSQDERMRSPQN |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 74 kDa |
| Gene Name | nucleolar protein 4-like |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | C20orf112; C20orf113; dJ1184F4.2; dJ1184F4.4 |
| Note | Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Rabbit: 92% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
Be the first one to submit a review
