ALG1 Rabbit Polyclonal Antibody

CAT#: TA331088

Reviews ()
Write a review

Rabbit polyclonal Anti-ALG1 Antibody



USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ALG1 antibody: synthetic peptide directed towards the N terminal of human ALG1. Synthetic peptide located within the following region: VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
Background ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).The biosynthesis of lipid-linked oligosaccharides is highly conserved among eukaryotes and is catalyzed by 14 glycosyltransferases in an ordered stepwise manner. Mannosyltransferase I (MT I) catalyzes the first mannosylation step in this process. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-421 BM767933.1 1-421 422-1179 AY359073.1 416-1173 1180-1444 CA455103.1 259-523 1445-1939 CD366777.1 17-511 c 1940-2122 BC031095.1 1931-2113 2123-2149 BQ002699.1 1-27 c
Synonyms CDG1K; hMat-1; HMAT1; HMT-1; HMT1; Mat-1; MT-1
Note Human: 100%; Yeast: 100%; Mouse: 85%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Metabolic pathways, N-Glycan biosynthesis
Other products for "ALG1"
Frequently bought together (3)
Recombinant protein of human asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S. cerevisiae) (ALG1)
    • 20 ug

USD 748.00


Transient overexpression lysate of asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S. cerevisiae) (ALG1)
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies