C6orf58 Rabbit Polyclonal Antibody

CAT#: TA330846

Rabbit Polyclonal Anti-C6orf58 Antibody

Product Images

Host: Rabbit; Target Name: C6orf58; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C6orf58 antibody is: synthetic peptide directed towards the N-terminal region of Human C6orf58. Synthetic peptide located within the following region: ILWGLPLQYGWQYRTGRLADPTRRTNCGYESGDHMCISVDSWWADLNYFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: chromosome 6 open reading frame 58
• Database Link:
  NP_001010905
  Entrez Gene 352999 Human
  UniProt ID Q6P5S2
• Background: The function of this protein remains unknown.
• Synonyms: LEG1
• Note: Human: 100%; Pig: 86%; Bovine: 85%; Guinea pig: 85%; Horse: 79%; Rabbit: 79%; Dog: 77%

Reference Data

• Protein Families: Secreted Protein