TRIM16L Rabbit Polyclonal Antibody

CAT#: TA330798

Reviews ()
Write a review

Rabbit Polyclonal Anti-TRIM16L Antibody



Get 29% off western blot control. View details.

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TRIM16L antibody is: synthetic peptide directed towards the N-terminal region of Human TRIM16L. Synthetic peptide located within the following region: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name tripartite motif containing 16-like
Background The function of this protein remains unknown.
Synonyms TRIM70
Note Human: 100%; Pig: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%; Rat: 85%; Bovine: 77%
Reference Data
Protein Families Druggable Genome
Other products for "TRIM16L"
Frequently bought together (2)
Transient overexpression lysate of tripartite motif-containing 16-like (TRIM16L)
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies