TMEM215 Rabbit Polyclonal Antibody

CAT#: TA330790

Rabbit Polyclonal Anti-TMEM215 Antibody

Product Images

Host: Rabbit; Target Name: TMEM215; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMEM215 antibody is: synthetic peptide directed towards the N-terminal region of Human TMEM215. Synthetic peptide located within the following region: WVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: transmembrane protein 215
• Database Link:
  NP_997723
  Entrez Gene 401498 Human
  UniProt ID Q68D42
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp686I2292; FLJ43330
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane