MRPL14 Rabbit Polyclonal Antibody

SKU TA330716

Rabbit Polyclonal Anti-MRPL14 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MRPL14 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL14. Synthetic peptide located within the following region: MTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRKREGEYSKVLAIAQNFV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 15 kDa
• Gene Name: mitochondrial ribosomal protein L14
• Database Link:
  NP_115487
  Q6P1L8
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found at 17p13.3.
• Synonyms: L14mt; L32mt; MRP-L14; MRP-L32; MRPL32; RMPL32; RPML32
• Note: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Goat: 86%; Horse: 86%; Bovine: 86%; Zebrafish: 85%; Pig: 79%

Reference Data