Pdzd4 Rabbit Polyclonal Antibody

CAT#: TA330706

Rabbit Polyclonal Anti-Pdzd4 Antibody

Product Images

Host: Rabbit; Target Name: Pdzd4; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Pdzd4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Pdzd4. Synthetic peptide located within the following region: SEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: PDZ domain containing 4
• Database Link:
  NP_001025039
  Entrez Gene 245469 Mouse
  UniProt ID Q9QY39
• Background: The function of this protein remains unknown.
• Synonyms: FLJ34125; KIAA1444; LU1; PDZK4; PDZRN4L
• Note: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%