MOSC2 (MARC2) Rabbit Polyclonal Antibody

CAT#: TA330662

Rabbit Polyclonal Anti-MARC2 Antibody

Product Images

Host: Rabbit; Target Name: MARC2; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MARC2 antibody is: synthetic peptide directed towards the C-terminal region of Human MARC2. Synthetic peptide located within the following region: ACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: mitochondrial amidoxime reducing component 2
• Database Link:
  NP_060368
  Entrez Gene 54996 Human
  UniProt ID Q969Z3
• Background: As a component of the benzamidoxime prodrug-converting complex, MARC2 is required to reduce N-hydroxylated prodrugs, such as benzamidoxime. It also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine.
• Synonyms: MOSC2
• Note: Human: 100%; Bovine: 91%; Dog: 82%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane