HOXA7 Rabbit Polyclonal Antibody

CAT#: TA330638

Rabbit Polyclonal Anti-HOXA7 Antibody

Product Images

WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateHOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HOXA7 antibody: synthetic peptide directed towards the N terminal of human HOXA7. Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: homeobox A7
• Database Link:
  NP_008827
  Entrez Gene 3204 Human
  UniProt ID P31268
• Background: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
• Synonyms: ANTP; HOX1; HOX1.1; HOX1A
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Transcription Factors