RSPRY1 Rabbit Polyclonal Antibody

SKU TA330497

Rabbit Polyclonal Anti-RSPRY1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RSPRY1 antibody: synthetic peptide directed towards the N terminal of human RSPRY1. Synthetic peptide located within the following region: RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: ring finger and SPRY domain containing 1
• Database Link:
  NP_588609
  Q96DX4
• Background: RSPRY1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of RSPRY1 remains unknown.
• Synonyms: SEMDFA
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein