NFAT4 (NFATC3) Rabbit Polyclonal Antibody

CAT#: TA330164

Rabbit Polyclonal Anti-NFATC3 Antibody

Product Images

WB Suggested Anti-NFATC3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: NFATC3; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0ug/ml

• 

  Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-NFATC3 antibody (P100975_P050)

• 

  Rabbit Anti-NFATC3 Antibody; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 115 kDa
• Gene Name: nuclear factor of activated T-cells 3
• Database Link:
  NP_004546
  Entrez Gene 18021 MouseEntrez Gene 4775 Human
  UniProt ID Q12968
• Background: NFATC3 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. NFATC3 plays a role in the regulation of gene expression in T cells and immature thymocytes.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene.
• Synonyms: NFAT4; NFATX
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 92%; African clawed frog: 91%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Axon guidance, B cell receptor signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway