DBPA (YBX3) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CSDA antibody: synthetic peptide directed towards the N terminal of human CSDA. Synthetic peptide located within the following region: AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 40 kDa |
| Gene Name | Y-box binding protein 3 |
| Database Link | |
| Background | Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation. |
| Synonyms | CSDA; CSDA1; DBPA; ZONAB |
| Note | Immunogen sequence homology: Human: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Guinea pig: 84% |
| Reference Data | |
| Protein Categories | Growth Factors, Intracellular Proteins, Transciption Factors |
| Protein Families | Transcription Factors |
| Protein Pathways | Tight junction |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Modulating the endometrial epithelial proteome and secretome in preparation for pregnancy: The role of ovarian steroid and pregnancy hormones
Greening, Nguyen, Evans et al
J Proteomics (2016) 144, 99-112 DOI: 10.1016/j.jprot.2016.05.026
Greening, Nguyen, Evans et al
J Proteomics (2016) 144, 99-112 DOI: 10.1016/j.jprot.2016.05.026
Cited by 51
AI Summary: In this study, OriGene’s rabbit anti-YBX3 antibody was used for immunoblotting to detect YBX3 protein expression in endometrial epithelial cells, contributing to the analysis of hormone-regulated proteomic changes during preparation for pregnancy.
Snippet: For immunoblotting (15 μg of protein), membranes were probed with primary antibodies [rabbit anti-YBX3 (Origene;1:1500), goat anti-SOD1 (C-17) (Santa Cruz Biotechnology;1:1000), rabbit anti-LIMS1/Pinch-1/2 (H-300) (Santa Cruz Biotechnology;1:1000),
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
