Nr5a1 Rabbit Polyclonal Antibody

CAT#: TA329987

Rabbit Polyclonal Anti-NR5A1 Antibody

Product Images

WB Suggested Anti-NR5A1 Antibody Titration: 0.3125 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Adrenal gland

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR5A1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: nuclear receptor subfamily 5, group A, member 1
• Database Link:
  NP_620639
  Entrez Gene 2516 Human
  UniProt ID P33242
• Background: NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300.
• Synonyms: AD4BP; ELP; FTZ1; FTZF1; POF7; SF-1; SF1; STF-1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Human: 93%; Sheep: 93%; Bovine: 93%