ZNF341 Rabbit Polyclonal Antibody

CAT#: TA329643

Rabbit Polyclonal anti-ZNF341 antibody

Product Images

WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-ZNF341 Antibody; Paraffin Embedded Tissue: Human Intestine; Cellular Data: Epithelial cells of intestinal villas; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the middle region of human ZNF341. Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: zinc finger protein 341
• Database Link:
  NP_116208
  Entrez Gene 84905 Human
  UniProt ID Q9BYN7
• Background: The ZNF341 gene is located on chromosome 20.
• Synonyms: OTTHUMP00000030667; OTTHUMP00000030670; zinc finger protein 341
• Note: Immunogen sequence homology: Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%

Reference Data

• Protein Families: Transcription Factors