OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RGS7 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA329134
Rabbit Polyclonal anti-RGS7 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY419005 Transient overexpression lysate of regulator of G-protein signaling 7 (RGS7) (as WB positive control) 100 ug
$436.00
TP305284 Recombinant protein of human regulator of G-protein signaling 7 (RGS7), 20 µg
20 ug
$867.00

View other "RGS7 or NM_002924" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-RGS7 antibody is: synthetic peptide directed towards the N-terminal region of Human RGS7. Synthetic peptide located within the following region: GNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 46 kDa
Gene Name regulator of G-protein signaling 7
Database Link
Background RGS7 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. RGS7 may play a role in synaptic vesicle exocytosis and may play important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations.
Synonyms OTTHUMP00000037994; regulator of G-protein signaling 7; regulator of G-protein signaling RGS7; regulator of G-protein signalling 7
Note Immunogen sequence homology: Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 92%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products