C1orf25 (TRMT1L) Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "C1orf25"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C1ORF25 antibody: synthetic peptide directed towards the N terminal of human C1ORF25. Synthetic peptide located within the following region: QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 61 kDa |
Gene Name | tRNA methyltransferase 1 like |
Database Link | |
Background | Although C1orf25 is similar to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms, the true function of C1orf25 protein is not known. |
Synonyms | bG120K12.3; C1orf25; MST070; MSTP070; TRM1L |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 92%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.