Germany
Japan
United Kingdom
China
C1orf25 (TRMT1L) Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "C1orf25"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-C1ORF25 antibody: synthetic peptide directed towards the N terminal of human C1ORF25. Synthetic peptide located within the following region: QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 61 kDa |
| Gene Name | tRNA methyltransferase 1 like |
| Database Link | |
| Background | Although C1orf25 is similar to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms, the true function of C1orf25 protein is not known. |
| Synonyms | bG120K12.3; C1orf25; MST070; MSTP070; TRM1L |
| Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 92%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.