OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBM10 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA329114
Rabbit Polyclonal anti-RBM10 antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407185 Transient overexpression lysate of RNA binding motif protein 10 (RBM10), transcript variant 2 (as WB positive control) 100 ug
$436.00

View other "RBM10 or NM_005676" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10. Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 104 kDa
Gene Name RNA binding motif protein 10
Database Link
Background RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
Synonyms DXS8237E; GPATC9; GPATCH9; S1-1; TARPS; ZRANB5
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Down regulation of RBM10 promotes proliferation and metastasis via miR-224-5p/RBM10/p53 feedback loop in lung adenocarcinoma
Sun, Jia, Yu
Heliyon (2024) 10 (15), e35001 DOI: 10.1016/j.heliyon.2024.e35001
Cited by 3
AI Summary: OriGene products, specifically the RBM10 antibody (TA329114) and the p53 antibody (TA811000S), were used for protein detection in western blot experiments to investigate the molecular mechanisms underlying lung adenocarcinoma proliferation and metastasis in this study.
Snippet: Antibodies against RBM10, β-actin and p53 were purchased from CST (#30774), Origene (TA329114), Origene (TA811000S), Abcam (Ab26). Protein isolation and western blotting was performed as described elsewhere [17]
WB
Expression pattern, immune signature, and prognostic value of RBM10 in human cancers
Sun, Jia, Yu
Histol Histopathol (2024)
AI Summary: OriGene’s RBM10 antibody (TA329114) was used for immunohistochemistry to evaluate RBM10 protein expression in various tumor tissues, contributing to the study’s analysis of RBM10’s role in cancer.
Snippet: ancreatic adenocarcinoma (PAAD), and Liver hepatocellular carcinoma (LIHC) was purchased from the Shanghai Outdo Biotech Company to evaluate differences in RBM10 expression at the protein level. Briefly, the microarray was stained with RBM10 (TA329114, Origene, 1:200) overnight at 4º C. …
IHC
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products