IL1RA (IL1RN) (NM_173843) Human Recombinant Protein

  • MVPro

    Full-length human proteins expressed in HEK293T cells

SKU
TP302447
Purified recombinant protein of Homo sapiens interleukin 1 receptor antagonist (IL1RN), transcript variant 4, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202447 protein sequence
Red=Cloning site Green=Tags(s)

MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGG
KMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSL
TNMPDEGVMVTKFYFQEDE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_776215
Locus ID 3557
UniProt ID P18510
Cytogenetics 2q14.1
RefSeq Size 1973
RefSeq ORF 477
Synonyms DIRA; ICIL-1RA; IL-1ra; IL-1ra3; IL-1RN; IL1F3; IL1RA; IRAP; MVCD4
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Aug 2020]
Protein Families Druggable Genome, Secreted Protein
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
PH302447 IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776215) 10 ug
$3,255.00
PH312460 IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_000568) 10 ug
$3,255.00
PH318518 IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776214) 10 ug
$3,255.00
LC403570 IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403571 IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406440 IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424628 IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403570 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 1 100 ug
$436.00
LY403571 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 4 100 ug
$436.00
LY406440 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 2 100 ug
$436.00
LY424628 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 3 100 ug
$436.00
TP312460 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3, 20 µg 20 ug
$737.00
TP318518 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 1, 20 µg 20 ug
$737.00
TP720025 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3 10 ug
$170.00
TP760033 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.