IL1RA (IL1RN) (NM_173843) Human Recombinant Protein

SKU TP302447L

Purified recombinant protein of Homo sapiens interleukin 1 receptor antagonist (IL1RN), transcript variant 4, 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202447 protein sequence; Red=Cloning site Green=Tags(s); ; MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGG; KMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSL; TNMPDEGVMVTKFYFQEDE; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_776215
• Locus ID: 3557
• UniProt ID: P18510
• Cytogenetics: 2q14.1
• RefSeq Size: 1973
• RefSeq ORF: 477
• Synonyms: DIRA; ICIL-1RA; IL-1ra; IL-1ra3; IL-1RN; IL1F3; IL1RA; IRAP; MVCD4
• Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Aug 2020]
• Protein Families: Druggable Genome, Secreted Protein