IL1RA (IL1RN) (NM_173842) Human Mass Spec Standard

SKU
PH318518
IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776214)
  $3,360.00
3 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218518
Predicted MW 17.1 kDa
Protein Sequence
Protein Sequence
>RC218518 representing NM_173842
Red=Cloning site Green=Tags(s)

MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEK
IDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAA
CPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_776214
RefSeq Size 1760
RefSeq ORF 531
Synonyms DIRA; ICIL-1RA; IL-1ra; IL-1ra3; IL-1RN; IL1F3; IL1RA; IRAP; MVCD4
Locus ID 3557
UniProt ID P18510
Cytogenetics 2q14.1
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. provided by RefSeq, Aug 2020
Protein Families Druggable Genome, Secreted Protein
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "IL1RA" proteins (15)
SKU Description Size Price
PH302447 IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776215) 10 ug
$3,360.00
PH312460 IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_000568) 10 ug
$3,360.00
LC403570 Lyophilized IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403571 Lyophilized IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406440 Lyophilized IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424628 Lyophilized IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403570 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403571 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY406440 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424628 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP302447 Purified recombinant protein of Homo sapiens interleukin 1 receptor antagonist (IL1RN), transcript variant 4, 20 µg 20 ug
$737.00
TP312460 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3, 20 µg 20 ug
$737.00
TP318518 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 1, 20 µg 20 ug
$737.00
TP720025 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3 10 ug
$175.00
TP760033 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products