IL1RA (IL1RN) (NM_173843) Human Mass Spec Standard

SKU
PH302447
IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776215)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202447]
Predicted MW 17.9 kDa
Protein Sequence
Protein Sequence
>RC202447 protein sequence
Red=Cloning site Green=Tags(s)

MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGG
KMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSL
TNMPDEGVMVTKFYFQEDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_776215
RefSeq Size 1973
RefSeq ORF 477
Synonyms DIRA; ICIL-1RA; IL-1ra; IL-1ra3; IL-1RN; IL1F3; IL1RA; IRAP; MVCD4
Locus ID 3557
UniProt ID P18510
Cytogenetics 2q14.1
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Aug 2020]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:IL1RA (IL1RN) (NM_173843) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312460 IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_000568) 10 ug
$3,255.00
PH318518 IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776214) 10 ug
$3,255.00
LC403570 IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403571 IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406440 IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424628 IL1RN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403570 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 1 100 ug
$436.00
LY403571 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 4 100 ug
$436.00
LY406440 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 2 100 ug
$436.00
LY424628 Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 3 100 ug
$436.00
TP302447 Purified recombinant protein of Homo sapiens interleukin 1 receptor antagonist (IL1RN), transcript variant 4, 20 µg 20 ug
$737.00
TP312460 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3, 20 µg 20 ug
$737.00
TP318518 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 1, 20 µg 20 ug
$737.00
TP720025 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3 10 ug
$170.00
TP760033 Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.