IGF1 Receptor (IGF1R) (NM_000875) Human Tagged ORF Clone

SKU
RC600009
IGF1R (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens insulin-like growth factor 1 receptor, Signal peptide (1-30) plus EC domain (741-935)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$589.00 MSRP $1,170.00 MSRP $1,170.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IGF1 Receptor
Synonyms CD221; IGFIR; IGFR; JTK13
Vector pCMV6-XL5-DDK-His
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>RC600009 representing leader sequence plus the extracellular domain region of NM_000875
Red=Cloning site Blue=ORF Green=Tags(s)

GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
CGATCGC
C

ATGAAGTCTGGCTCCGGAGGAGGGTCCCCGACCTCGCTGTGGGGGCTCCTGTTTCTCTCCGCCGCGCTCT
CGCTCTGGCCGACGAGTGGAGATGTCATGCAAGTGGCCAACACCACCATGTCCAGCCGAAGCAGGAACAC
CACGGCCGCAGACACCTACAACATCACCGACCCGGAAGAGCTGGAGACAGAGTACCCTTTCTTTGAGAGC
AGAGTGGATAACAAGGAGAGAACTGTCATTTCTAACCTTCGGCCTTTCACATTGTACCGCATCGATATCC
ACAGCTGCAACCACGAGGCTGAGAAGCTGGGCTGCAGCGCCTCCAACTTCGTCTTTGCAAGGACTATGCC
CGCAGAAGGAGCAGATGACATTCCTGGGCCAGTGACCTGGGAGCCAAGGCCTGAAAACTCCATCTTTTTA
AAGTGGCCGGAACCTGAGAATCCCAATGGATTGATTCTAATGTATGAAATAAAATACGGATCACAAGTTG
AGGATCAGCGAGAATGTGTGTCCAGACAGGAATACAGGAAGTATGGAGGGGCCAAGCTAAACCGGCTAAA
CCCGGGGAACTACACAGCCCGGATTCAGGCCACATCTCTCTCTGGGAATGGGTCGTGGACAGATCCTGTG
TTCTTCTATGTCCAGGCCAAAACAGGATATGAAAACTTCATCCAT


ACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATTAATGAGATC
TGGTACCGATATCAAGCTTGTCGACTCTAGA
Protein Sequence
>RC600009 representing signal peptide plus the extracellular domain region of NM_000875
Red=Cloning sites Green= DDK and 6XHIS Tags

MKSGSGGGSPTSLWGLLFLSAALSLWPTSGDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFL
KWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPV
FFYVQAKTGYENFIH

TRSGTRSGDYKDDDDKGSHHHHHH
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NM_000875
ORF Size 1280 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000875.3, NP_000866.1
RefSeq Size 12235 bp
RefSeq ORF 4104 bp
Locus ID 3480
UniProt ID P08069
Cytogenetics 15q26.3
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Adherens junction, Colorectal cancer, Endocytosis, Focal adhesion, Glioma, Long-term depression, Melanoma, Oocyte meiosis, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer
MW 25.2 kDa
Summary This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]
Write Your Own Review
You're reviewing:IGF1 Receptor (IGF1R) (NM_000875) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214928 IGF1R (Myc-DDK-tagged)-Human insulin-like growth factor 1 receptor (IGF1R) 10 ug
$1,754.00
RC214928L1 Lenti ORF clone of Human insulin-like growth factor 1 receptor (IGF1R), Myc-DDK-tagged 10 ug
$2,054.00
RC214928L2 Lenti ORF clone of Human insulin-like growth factor 1 receptor (IGF1R), mGFP tagged 10 ug
$2,054.00
RC214928L3 Lenti ORF clone of Human insulin-like growth factor 1 receptor (IGF1R), Myc-DDK-tagged 10 ug
$2,054.00
RC214928L4 Lenti ORF clone of Human insulin-like growth factor 1 receptor (IGF1R), mGFP tagged 10 ug
$2,054.00
RG214928 IGF1R (tGFP-tagged) - Human insulin-like growth factor 1 receptor (IGF1R) 10 ug
$789.00 MSRP $1,954.00 MSRP $1,954.00
SC124152 IGF1R (untagged)-Human insulin-like growth factor 1 receptor (IGF1R) 10 ug
$1,755.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.