OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD70 (NM_001252) Human Mass Spec Standard

Be the first to review this product
SKU
PH300410
CD70 MS Standard C13 and N15-labeled recombinant protein (NP_001243)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA813221 CD70 mouse monoclonal antibody,clone OTI5D8 100 ul
$447.00
LY400501 Transient overexpression lysate of CD70 molecule (CD70) (as WB positive control) 100 ug
$436.00

Other products for "CD70 or NM_001252"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200410
Predicted MW 21.1 kDa
Protein Sequence
Protein Sequence
>RC200410 protein sequence
Red=Cloning site Green=Tags(s)

MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD
PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI
SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001243
RefSeq Size 913
RefSeq ORF 579
Synonyms CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A
Locus ID 970
UniProt ID P32970
Cytogenetics 19p13.3
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. provided by RefSeq, Jul 2008
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD70" proteins (6)
SKU Description Size Price
LC400501 Lyophilized CD70 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400501 Transient overexpression lysate of CD70 molecule (CD70) (as WB positive control) 100 ug
$436.00
TP300410 Recombinant protein of human CD70 molecule (CD70), 20 µg 20 ug
$867.00
TP700287 Purified recombinant protein of human CD70 molecule (CD70), with C-terminal Fc tag, expressed in human cells, 20 µg 20 ug
$900.00
TP723962 Recombinant human CD70 protein with N-terminal mouse Fc and C-terminal 6×His tag 100 ug
$905.00
TP724019 Recombinant human CD70 protein with C-terminal human Fc and 6×His tag 100 ug
$905.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products