rev protein (NC_001722) Virus Tagged ORF Clone
SKU
VC101748
Myc-DDK-tagged ORF clone of viral ORF for rev protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056843
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Virus Tagged ORF Clone |
---|---|
Target Symbol | rev protein |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>The Viral ORF clone VC101748 represents NCBI reference of NP_056843 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTGAGAGAGCTGACGAGGAAGGCCTCCAGGGGAAGCTCCGCCTGCTTAGATTGCTGCATCAGACCA ATCCCTACCCCCAAGGTCCTGGGACCGCCAGTCAGAGGAGAAACAGAAGGCGGCGGAGAAGGAGACAGTG GCTTAGGTTGGTGGCCTTGGCAAATAAGCTGTGTGCGGTCCCTGACCCGCCCACCGACAGCCCACTGGAT CGGGCCATCCAGCATCTGCAGCGCCTTACCATCCAGGAGCTCCCAGACCCCCCGACCGATCTTCCTGAGA GCAACAGTAACCAGGGCCTCGCGGAAACC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC101748 representing NP_056843
Red=Cloning sites Green=Tags MSERADEEGLQGKLRLLRLLHQTNPYPQGPGTASQRRNRRRRRRRQWLRLVALANKLCAVPDPPTDSPLD RAIQHLQRLTIQELPDPPTDLPESNSNQGLAET TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001722 |
ORF Size | 309 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NC_001722.1, NP_056843 |
RefSeq ORF | 309 bp |
Locus ID | 1724716 |
MW | 11.8 kDa |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
VC101743 | Myc-DDK-tagged ORF clone of viral ORF for gag polyprotein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056837 | 10 ug |
$533.00
|
|
VC101744 | Myc-DDK-tagged ORF clone of viral ORF for vif protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056839 | 10 ug |
$330.00
|
|
VC101745 | Myc-DDK-tagged ORF clone of viral ORF for vpx protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056840 | 10 ug |
$225.00
|
|
VC101746 | Myc-DDK-tagged ORF clone of viral ORF for vpr protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056841 | 10 ug |
$289.00
|
|
VC101747 | Myc-DDK-tagged ORF clone of viral ORF for tat protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056842 | 10 ug |
$165.00
|
|
VC101749 | Myc-DDK-tagged ORF clone of viral ORF for env polyprotein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056844 | 10 ug |
$866.00
|
|
VC101750 | Myc-DDK-tagged ORF clone of viral ORF for nef protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056845 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.