vpx protein (NC_001722) Virus Tagged ORF Clone

SKU
VC101745
Myc-DDK-tagged ORF clone of viral ORF for vpx protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056840
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol vpx protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101745 represents NCBI reference of NP_056840 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGATCCTCGCGAACGAGTCCCCCCCGGTAATTCCGGCGAAGAAACCATCGGAGAAGCTTTCGAGT
GGCTGGAGAGGACCATCGAGGCTCTTAATAGGGAGGCCGTCAATCATCTGCCCCGGGAACTGATATTCCA
GGTTTGGCAACGCAGCTGGCGGTATTGGCATGACGAACAGGGAATGTCCGCCTCCTATACCAAGTATCGG
TACCTTTGCTTGATGCAGAAGGCTATCTTCACACATTTTAAGCGCGGCTGCACTTGTTGGGGGGAAGATA
TGGGACGGGAAGGCTTGGAGGACCAGGGTCCACCCCCACCCCCTCCCCCTGGGCTCGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101745 representing NP_056840
Red=Cloning sites Green=Tags

MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYR
YLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001722
ORF Size 339 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001722.1, NP_056840
RefSeq ORF 339 bp
Locus ID 1724714
MW 13.2 kDa
Write Your Own Review
You're reviewing:vpx protein (NC_001722) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101743 Myc-DDK-tagged ORF clone of viral ORF for gag polyprotein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056837 10 ug
$533.00
VC101744 Myc-DDK-tagged ORF clone of viral ORF for vif protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056839 10 ug
$330.00
VC101746 Myc-DDK-tagged ORF clone of viral ORF for vpr protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056841 10 ug
$289.00
VC101747 Myc-DDK-tagged ORF clone of viral ORF for tat protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056842 10 ug
$165.00
VC101748 Myc-DDK-tagged ORF clone of viral ORF for rev protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056843 10 ug
$165.00
VC101749 Myc-DDK-tagged ORF clone of viral ORF for env polyprotein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056844 10 ug
$866.00
VC101750 Myc-DDK-tagged ORF clone of viral ORF for nef protein [Human immunodeficiency virus 2], codon optimized for human cell expression, NP_056845 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.