NPC2 (NM_006432) Human Tagged ORF Clone

SKU
RC200282
NPC2 (Myc-DDK-tagged)-Human Niemann-Pick disease, type C2 (NPC2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NPC2
Synonyms EDDM1; HE1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200282 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGTTTCCTGGCAGCTACATTCCTGCTCCTGGCGCTCAGCACCGCTGCCCAGGCCGAACCGGTGCAGT
TCAAGGACTGCGGTTCTGTGGATGGAGTTATAAAGGAAGTGAATGTGAGCCCATGCCCCACCCAACCCTG
CCAGCTGAGCAAAGGACAGTCTTACAGCGTCAATGTCACCTTCACCAGCAATATTCAGTCTAAAAGCAGC
AAGGCCGTGGTGCATGGCATCCTGATGGGCGTCCCAGTTCCCTTTCCCATTCCTGAGCCTGATGGTTGTA
AGAGTGGAATTAACTGCCCTATCCAAAAAGACAAGACCTATAGCTACCTGAATAAACTACCAGTGAAAAG
CGAATATCCCTCTATAAAACTGGTGGTGGAGTGGCAACTTCAGGATGACAAAAACCAAAGTCTCTTCTGC
TGGGAAATCCCAGTACAGATCGTTTCTCATCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200282 protein sequence
Red=Cloning site Green=Tags(s)

MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSS
KAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFC
WEIPVQIVSHL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006432
ORF Size 453 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006432.5
RefSeq Size 921 bp
RefSeq ORF 456 bp
Locus ID 10577
UniProt ID P61916
Cytogenetics 14q24.3
Domains ML
Protein Families Druggable Genome, Secreted Protein
MW 16.6 kDa
Summary This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NPC2 (NM_006432) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200282L1 Lenti ORF clone of Human Niemann-Pick disease, type C2 (NPC2), Myc-DDK-tagged 10 ug
$450.00
RC200282L2 Lenti ORF clone of Human Niemann-Pick disease, type C2 (NPC2), mGFP tagged 10 ug
$450.00
RC200282L3 Lenti ORF clone of Human Niemann-Pick disease, type C2 (NPC2), Myc-DDK-tagged 10 ug
$450.00
RC200282L4 Lenti ORF clone of Human Niemann-Pick disease, type C2 (NPC2), mGFP tagged 10 ug
$450.00
RG200282 NPC2 (tGFP-tagged) - Human Niemann-Pick disease, type C2 (NPC2) 10 ug
$489.00
SC116115 NPC2 (untagged)-Human Niemann-Pick disease, type C2 (NPC2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.