RGS3 (NM_021106) Human Recombinant Protein

SKU
TP324111
Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224111 representing NM_021106
Red=Cloning site Green=Tags(s)

MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATS
EGSPPGPDAPPSKDVPPCQEPPPAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPP
SQVSLPAKALTEDTMSSGDLLAATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVE
EGEEGEEDEDEDTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASD
TTLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAK
DMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEEN
LEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFG
LMEKDSYPRFLRSDLYLDLINQKKMSPPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_066929
Locus ID 5998
UniProt ID P49796
Cytogenetics 9q32
RefSeq Size 2914
RefSeq ORF 1557
Synonyms C2PA; PDZ-RGS3; RGP3
Summary This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013]
Protein Families Druggable Genome
Protein Pathways Axon guidance
Write Your Own Review
You're reviewing:RGS3 (NM_021106) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306471 RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_602299) 10 ug
$3,255.00
PH324058 RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_570613) 10 ug
$3,255.00
PH324111 RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_066929) 10 ug
$3,255.00
LC402835 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403390 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408751 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408949 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413532 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402835 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2 100 ug
$665.00
LY403390 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 5 100 ug
$436.00
LY408751 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 4 100 ug
$436.00
LY408949 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 1 100 ug
$436.00
LY413532 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 3 100 ug
$665.00
TP306471 Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 4, 20 µg 20 ug
$737.00
TP324058 Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 1, 20 µg 20 ug
$737.00
TP760493 Purified recombinant protein of Human regulator of G-protein signaling 3 (RGS3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.