OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RGS3 (NM_021106) Human Mass Spec Standard

Be the first to review this product
SKU
PH324111
RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_066929)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330393 Rabbit Polyclonal Anti-RGS3 Antibody
100 ul
$585.00
LY402835 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "RGS3 or NM_021106"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224111
Predicted MW 56.4 kDa
Protein Sequence
Protein Sequence
>RC224111 representing NM_021106
Red=Cloning site Green=Tags(s)

MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATS
EGSPPGPDAPPSKDVPPCQEPPPAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPP
SQVSLPAKALTEDTMSSGDLLAATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVE
EGEEGEEDEDEDTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASD
TTLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAK
DMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEEN
LEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFG
LMEKDSYPRFLRSDLYLDLINQKKMSPPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066929
RefSeq Size 2914
RefSeq ORF 1557
Synonyms C2PA; PDZ-RGS3; RGP3
Locus ID 5998
UniProt ID P49796
Cytogenetics 9q32
Summary This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. provided by RefSeq, Jan 2013
Protein Families Druggable Genome
Protein Pathways Axon guidance
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RGS3" proteins (16)
SKU Description Size Price
PH306471 RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_602299) 10 ug
$3,360.00
PH324058 RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_570613) 10 ug
$3,360.00
LC402835 Lyophilized RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403390 Lyophilized RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408751 Lyophilized RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408949 Lyophilized RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413532 Lyophilized RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402835 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY403390 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY408751 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY408949 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY413532 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP306471 Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 4, 20 µg 20 ug
$737.00
TP324058 Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 1, 20 µg 20 ug
$737.00
TP324111 Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 2, 20 µg 20 ug
$737.00
TP760493 Purified recombinant protein of Human regulator of G-protein signaling 3 (RGS3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products