RGS3 (NM_021106) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC224111] |
Predicted MW | 56.4 kDa |
Protein Sequence |
Protein Sequence
>RC224111 representing NM_021106
Red=Cloning site Green=Tags(s) MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATS EGSPPGPDAPPSKDVPPCQEPPPAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPP SQVSLPAKALTEDTMSSGDLLAATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVE EGEEGEEDEDEDTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASD TTLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAK DMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEEN LEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFG LMEKDSYPRFLRSDLYLDLINQKKMSPPL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_066929 |
RefSeq Size | 2914 |
RefSeq ORF | 1557 |
Synonyms | C2PA; PDZ-RGS3; RGP3 |
Locus ID | 5998 |
UniProt ID | P49796 |
Cytogenetics | 9q32 |
Summary | This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH306471 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_602299) | 10 ug |
$3,255.00
|
|
PH324058 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_570613) | 10 ug |
$3,255.00
|
|
LC402835 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC403390 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408751 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408949 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413532 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY402835 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2 | 100 ug |
$665.00
|
|
LY403390 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 5 | 100 ug |
$436.00
|
|
LY408751 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 4 | 100 ug |
$436.00
|
|
LY408949 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 1 | 100 ug |
$436.00
|
|
LY413532 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 3 | 100 ug |
$665.00
|
|
TP306471 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP324058 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP324111 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP760493 | Purified recombinant protein of Human regulator of G-protein signaling 3 (RGS3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.