RGS3 (NM_130795) Human Mass Spec Standard

SKU
PH324058
RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_570613)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224058]
Predicted MW 100.8 kDa
Protein Sequence
Protein Sequence
>RC224058 representing NM_130795
Red=Cloning site Green=Tags(s)

MNRFNGLCKVCSERRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEH
WKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQR
HSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTIP
EESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPLD
LCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKF
CVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGA
EDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEPP
PAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLLA
ATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGERS
EAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPST
LKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPAG
KADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASK
AKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQ
KKMSPPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570613
RefSeq Size 3741
RefSeq ORF 2751
Synonyms C2PA; RGP3
Locus ID 5998
UniProt ID P49796
Cytogenetics 9q32
Summary This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013]
Protein Families Druggable Genome
Protein Pathways Axon guidance
Write Your Own Review
You're reviewing:RGS3 (NM_130795) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH306471 RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_602299) 10 ug
$3,255.00
PH324111 RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_066929) 10 ug
$3,255.00
LC402835 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403390 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408751 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408949 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413532 RGS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402835 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2 100 ug
$665.00
LY403390 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 5 100 ug
$436.00
LY408751 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 4 100 ug
$436.00
LY408949 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 1 100 ug
$436.00
LY413532 Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 3 100 ug
$665.00
TP306471 Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 4, 20 µg 20 ug
$737.00
TP324058 Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 1, 20 µg 20 ug
$737.00
TP324111 Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 2, 20 µg 20 ug
$737.00
TP760493 Purified recombinant protein of Human regulator of G-protein signaling 3 (RGS3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.