RGS3 (NM_130795) Human Recombinant Protein
SKU
TP324058
Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC224058 representing NM_130795
Red=Cloning site Green=Tags(s) MNRFNGLCKVCSERRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEH WKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQR HSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTIP EESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPLD LCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKF CVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGA EDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEPP PAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLLA ATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGERS EAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPST LKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPAG KADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASK AKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQ KKMSPPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 100.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_570613 |
Locus ID | 5998 |
UniProt ID | P49796 |
Cytogenetics | 9q32 |
RefSeq Size | 3741 |
RefSeq ORF | 2751 |
Synonyms | C2PA; RGP3 |
Summary | This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH306471 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_602299) | 10 ug |
$3,255.00
|
|
PH324058 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_570613) | 10 ug |
$3,255.00
|
|
PH324111 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_066929) | 10 ug |
$3,255.00
|
|
LC402835 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC403390 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408751 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408949 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413532 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY402835 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2 | 100 ug |
$665.00
|
|
LY403390 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 5 | 100 ug |
$436.00
|
|
LY408751 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 4 | 100 ug |
$436.00
|
|
LY408949 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 1 | 100 ug |
$436.00
|
|
LY413532 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 3 | 100 ug |
$665.00
|
|
TP306471 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP324111 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP760493 | Purified recombinant protein of Human regulator of G-protein signaling 3 (RGS3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.