TrkB (NTRK2) (NM_006180) Human Recombinant Protein
SKU
TP321794
Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC221794 representing NM_006180
Red=Cloning site Green=Tags(s) MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE IFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL SELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEE GKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVN LTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDN PTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQGVGPASVISND DDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKREL GEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLI MVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLV GENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPW YQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 90.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006171 |
Locus ID | 4915 |
UniProt ID | Q16620 |
Cytogenetics | 9q21.33 |
RefSeq Size | 5608 |
RefSeq ORF | 2514 |
Synonyms | DEE58; EIEE58; GP145-TrkB; OBHD; trk-B; TRKB |
Summary | This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | MAPK signaling pathway, Neurotrophin signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305129 | NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_001007098) | 10 ug |
$3,255.00
|
|
PH321794 | NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_006171) | 10 ug |
$3,255.00
|
|
LC400391 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416818 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422715 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422716 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422717 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY400391 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b | 100 ug |
$436.00
|
|
LY416818 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a | 100 ug |
$665.00
|
|
LY422715 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant c | 100 ug |
$665.00
|
|
LY422716 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant d | 100 ug |
$665.00
|
|
LY422717 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant e | 100 ug |
$665.00
|
|
TP305129 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b, 20 µg | 20 ug |
$737.00
|
|
TP700135 | Purified recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2(NTRK2), transcript variant c, with C-terminal DDK/His tag, expressed in human cells, 20 µg | 20 ug |
$867.00
|
|
TP710139 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a, residues 32-430aa, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
TP720421 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b | 10 ug |
$170.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.